Top Catalog English Version | My Account | 联系我们 | China












New Orphan Ligands

Endogenous peptide discovery of the rat circadian clock

Please contact us at if you are interested in purchasing the following products as a complete library.

Cat. # Name Sequence M.W
004-41 Pro-SAAS (221–239) AVDQDLGPEVPPENVLGAL 1931.99
004-42 Pro-SAAS (221–240) AVDQDLGPEVPPENVLGALL 2045.08
004-43 Pro-SAAS (221–241) AVDQDLGPEVPPENVLGALLR 2201.18
004-55 Pro-SAAS (221–242) / PEN (Rat) AVDQDLGPEVPPENVLGALLRV 2300.25
004-56 Pro-SAAS (245–260) / Big PEN (Rat) LENSSPQAPARRLLPP 1744.96
062-28 Prothyroliberin (25–50) LPEAAQEEGAVTPDLPGLENVQVRPE 2757.4
062-27 Prothyroliberin (83–103) EEEEKDIEAEERGDLGEGGAW 2347.02
062-23 Prothyroliberin (178–199) FIDPELQRSWEEKEGEGVLMPE 2617.25
053-37 Secretogranin 1 (372–380) SEESQEKEY 1127.46
053-38 Secretogranin 1 (416–432)  GRGREPGAYPALDSRQE 1857.91
053-21 Secretogranin 1 (513–532)  LGALFNPYFDPLQWKNSDFE 2400.14
053-39 Secretogranin 1 (585–594)  SFAKAPHLDL 1097.59
053-40 Secretogranin 1 (597–611)  Q(pyroglutamylation)YDDGVAELDQLLHY 1760.79
004-44 Secretogranin 2 (168–181)  FPLMYEENSRENPF 1771.8
004-45 Secretogranin 2 (169–181)  PLMYEENSRENPF 1624.73
047-95 Secretogranin 2 (184–216) / Secretoneurin TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ 3649.81
004-46 Secretogranin 2 (198–216)  ATLESVFQELGKLTGPSNQ 2018.04
004-47 Secretogranin 2 (205–216)  QELGKLTGPSNQ 1270.65
004-48 Secretogranin 2 (287–316)  SGHLGLPDEGNRKESKDQLSEDASKVITYL 3285.66
004-49 Secretogranin 2 (495–517)  PYDNLNDKDQELGEYLARMLVKY 2786.37
004-50 Secretogranin 2 (529–566)  VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAK 4179.99
047-98 Secretogranin 2 (529–568)  VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVS 4366.09
004-77 Secretogranin 2 (571–583) IPAGSLKNEDTPN 1354.67
004-78 Secretogranin 2 (571–584) IPAGSLKNEDTPNR 1510.78
004-79 Secretogranin 2 (571–585) IPAGSLKNEDTPNRQ 1638.84
004-80 Secretogranin 2 (595–611) VLEYLNQEQAEQGREHL 2055.01
004-39 Secretogranin 3 (23–36)  FPKPEGSQDKSLHN 1582.78
046-94 Tachykinin 3 (95–115)  NSQPDTPADVVEENTPSFGVL 2215.04
065-07 Provasopressin (24–32) Arginine-vasopressinCdYFQNCdPRG(amidation) 1083.44
065-08 Provasopressin (26–32)  FQNCPRG(amidation) 819.38
065-42 Provasopressin (151–165) VQLAGTQESVDSAKP 1528.77
065-43 Provasopressin (151–166) VQLAGTQESVDSAKPR 1684.88
065-44 Provasopressin (151–167)  VQLAGTQESVDSAKPRV 1783.95
065-45 Provasopressin (151–168)  VQLAGTQESVDSAKPRVY 1947.01
065-46 Provasopressin (152–168)  QLAGTQESVDSAKPRVY 1847.94
065-47 Provasopressin (153–168)  LAGTQESVDSAKPRVY 1719.88
065-48 Provasopressin (154–168)  AGTQESVDSAKPRVY 1606.8
065-49 Provasopressin (155–168)  GTQESVDSAKPRVY 1535.76
064-15 VIP peptides (125–137) HSDAVFTDNYTRL 1537.72
064-61 PEBP-1 (9–25)  AGPLSLQEVDEPPQHAL 1799.92
064-62 PEBP-1 (11–25) PLSLQEVDEPPQHAL 1671.85
064-63 PEBP-1 (28–46)  DYGGVTVDELGKVLTPTQV 1990.03
064-64 PEBP-1 (50–66)  PSSISWDGLDPGKLYTL 1847.93
064-65 PEBP-1 (174–187)  DDSVPKLHDQLAGK 1521.78
065-71 GABA(A) receptor subunit
alpha-6 (38–55)
064-41 Dihydropyrimidinase-related
 protein 2 (518–572)
064-42 Dihydropyrimidinase-related
 protein 2 (560–572)
064-43 Dihydropyrimidinase-related
protein 3 (558–570)
APPGGRSNITSLS1255.65 1255.65

Endogenous peptide discovery of the rat circadian clock: a focused study of the suprachiasmatic nucleus by ultrahigh performance tandem mass spectrometry.

Understanding how a small brain region, the suprachiasmatic nucleus (SCN), can synchronize the body's circadian rhythms is an ongoing research area. This important time-keeping system requires a complex suite of peptide hormones and transmitters that remain incompletely characterized. Here, capillary liquid chromatography and FTMS have been coupled with tailored software for the analysis of endogenous peptides present in the SCN of the rat brain. After ex vivo processing of brain slices, peptide extraction, identification, and characterization from tandem FTMS data with <5-ppm mass accuracy produced a hyperconfident list of 102 endogenous peptides, including 33 previously unidentified peptides, and 12 peptides that were post-translationally modified with amidation, phosphorylation, pyroglutamylation, or acetylation. This characterization of endogenous peptides from the SCN will aid in understanding the molecular mechanisms that mediate rhythmic behaviors in mammals.
Lee et al. Mol Cell Proteomics. 2010 Feb;9(2):285-97. Epub 2009 Nov 10



Copyright 2021 PHOENIX BIOTECH